<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14043
Description |
Uncharacterized protein |
Sequence | MICTDILVAHFRIAQVENATDRNSTALAQYQMQVETTALTRAIEEGQSFTRQLQEMWLFGQLNTIGDSEAKQRSDEAAKELSRLLQQLADAQKADPDDETKMEA |
Length | 104 |
Position | Head |
Organism | Hortaea werneckii EXF-2000 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Hortaea.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.575 |
Instability index | 47.25 |
Isoelectric point | 4.49 |
Molecular weight | 11718.93 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP14043
No repeats found
No repeats found
|