<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14041
| Description |
Uncharacterized protein |
| Sequence | MTDRLTQLQDAIDNMLTLQFTLQIYNQTKHPYADIPGQLSQAPKETKTETTQLTNGDAATQQPNGPSQPQQQAQQEGPEEEKPPVPDTPENFERALRELAQAMVLQEQQMEVLINSLPGLERSEAEQVQRMKALEAELREVEAERVKAEEERVKMLDALGGVMVGARRVP |
| Length | 170 |
| Position | Middle |
| Organism | Hortaea werneckii EXF-2000 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Teratosphaeriaceae> Hortaea.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.829 |
| Instability index | 56.02 |
| Isoelectric point | 4.58 |
| Molecular weight | 19088.19 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP14041
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 68.58| 16| 20| 121| 136| 1
---------------------------------------------------------------------------
93- 112 (18.75/ 8.46) ERALRELAQAMvlqeQQMEV
121- 136 (26.64/14.65) ERSEAEQVQRM....KALEA
144- 158 (23.19/11.94) ERVKAEE.ERV....KMLDA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.51| 10| 18| 61| 70| 2
---------------------------------------------------------------------------
61- 70 (20.08/ 8.46) QQPNGPSQPQ
81- 90 (19.43/ 8.00) EKPPVPDTPE
---------------------------------------------------------------------------
|