<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP14016
Description |
Uncharacterized protein |
Sequence | MDAGGDWRAQLQPERRSKIVNKIVLTLRKHLPVQVPEGQGLVELQRIAVRFEDKVYAAATTQAEYLRKISLKLLSMWSYTNTQQNPGPGSSTKGKKQKKLRCHFCKKGGHLKKDCLKRKLWFEKKGVAYDPTHKRTKAHENKNEGTVLKESGIAE |
Length | 155 |
Position | Tail |
Organism | Sorghum bicolor (Sorghum) (Sorghum vulgare) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> PACMAD clade>
Panicoideae> Andropogonodae> Andropogoneae> Sorghinae> Sorghum.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.848 |
Instability index | 40.05 |
Isoelectric point | 10.04 |
Molecular weight | 17681.34 |
Publications | PubMed=19189423
PubMed=29161754
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP14016
No repeats found
No repeats found
|