| Description | Uncharacterized protein |
| Sequence | MADILTQMQDEVDMLLNIMQSQLLQIRTRAPPSVPEGQQKLSSFAEKEAADKSENATQNSTQPAPPSDAAPALPTKEQFEGDLKEMAKDLVVKSQQIELLIANLPGVNTSEAEQVQRMKELERELEDLEGERLRAVEQKELLLKRVEEKIMGVGRVP |
| Length | 157 |
| Position | Middle |
| Organism | Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Epicoccum. |
| Aromaticity | 0.01 |
| Grand average of hydropathy | -0.604 |
| Instability index | 51.74 |
| Isoelectric point | 4.64 |
| Molecular weight | 17533.78 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP13967
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 149.72| 39| 39| 63| 101| 1
---------------------------------------------------------------------------
30- 55 (30.34/11.26) .APPS.....VPEGQQKLSSFAE..KEAADKSEN.....
63- 101 (63.25/29.31) PAPPSDAAPALPTKEQFEGDLKEMAKDLVVKSQQIELLI
105- 143 (56.14/25.41) PGVNTSEAEQVQRMKELERELEDLEGERLRAVEQKELLL
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) KLSSFAEKEAADKSE 2) LPTKEQF | 40 73 | 54 79 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab