| Description | Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MATPNSDQQTADVPRTGGYTRFELELEFVQCLANPAYLNFLATQKMYEKPEFVAYLGYLQYFKDPKYAKFLHHPGPTLWALEMLQQERFRREILNPGLMQKLVVEGQRNAVPGQQD |
| Length | 116 |
| Position | Middle |
| Organism | Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Epicoccum. |
| Aromaticity | 0.13 |
| Grand average of hydropathy | -0.532 |
| Instability index | 38.79 |
| Isoelectric point | 6.10 |
| Molecular weight | 13486.27 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP13963 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) RFRREIL 2) VPRTGGYTRFE | 88 13 | 94 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab