<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13960
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPAVIPPLDEQEYVDPQMPLAHLDADNNAIFHLMNSPFFDGASNNSAVYSIAQGHPNGMQILNDRPTYEAELRKYNLGLQYIVAGEPKAEGQPWLIQRQRKVLDMNGNPDTVNEGNFYTQGTRLLMAPSMLDVVQARLLTVSTRMQQMAELSKNMSHWSPATGHTYLPPSYELAKATDTASRTASRAASPILAPADLPDAAASQATAKDGSTTAPAAPDDSGFNDAFFLHSLHLTHAYGDEHMDANPLLGEPGAFVFANSRSHIDARNKAAQEQAATAQQTSSSQPPLRAESAAPGSVAPSAAATPRGGATPMVIDVPSRKGSVVGGVGGKDKEKEERRRRRKSRGLASPTSPTTPVGGGPAL |
Length | 363 |
Position | Head |
Organism | Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Epicoccum.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.494 |
Instability index | 50.56 |
Isoelectric point | 6.06 |
Molecular weight | 38598.64 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13960
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.82| 23| 23| 172| 194| 1
---------------------------------------------------------------------------
150- 169 (36.45/16.65) EL..SK...NMSHWSPATGHTYLPP
172- 194 (36.45/16.65) EL..AKATDTASRTASRAASPILAP
196- 218 (27.92/11.29) DLpdAAASQATAKDGSTTA.PA.AP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 90.44| 27| 28| 30| 56| 2
---------------------------------------------------------------------------
30- 56 (48.40/27.66) IFHLMNSPFFDGA..SNNSAVYSIAQGHP
59- 87 (42.04/23.26) MQILNDRPTYEAElrKYNLGLQYIVAGEP
---------------------------------------------------------------------------
|