<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13955

Description Uncharacterized protein
SequenceMTSRPGPGIHEQSRGSGVPSRNPNPQVRRRPSKPLNTALPPPDCIDPALDGDRASAYNGAAEPPRPLPRGRPQLFYGNAPSDGYELPVSSSFPYQPTANLPVPPRPGSVHLGDISNQRRIVPGGSGVKEYPNLQAPEVLTAPVHFPGGKAADVFPWTGNNPEDTLTEALVKVGISNKPQIMNETNTARPSLWSNLKNKSGLSTLSTLFVAVLEKRQQTGRLQEPNTFKPPPRLTLRDTAREQWLYDLSNPAVGLRRLSRTIPHGLTGKVLLEQCLNKNIPLPRALWLARCVGINELRAHKRKGQAGTVTWVRGWTSSVEQFLDSILSGIGTGEWKQRITYSLQLATFLYKEYLLDNDHFLDWILHSLGACTSERLFIWLLIVSIPAYWKDITSCRTRGKRLAEALLSHIAKASTSM
Length416
PositionKinase
OrganismEpicoccum nigrum (Soil fungus) (Epicoccum purpurascens)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Epicoccum.
Aromaticity0.07
Grand average of hydropathy-0.433
Instability index49.92
Isoelectric point9.84
Molecular weight45952.96
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.


Component of the srb8-11 complex. The srb8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The srb8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13955
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     170.87|      29|      59|      92|     120|       1
---------------------------------------------------------------------------
   31-   53 (27.23/ 9.10)	.PSKPL.NTALP.P....PDCID...PALDGDR..
   56-   85 (29.60/10.50)	.AYNGAAEPPRPlP...R.GRPQLfyGNAPSDGYE
   92-  120 (54.95/25.40)	FPYQPTANLPVP.P...RPGSVHL..GDISNQRRI
  127-  153 (23.25/ 6.77)	VKEYP..NLQAP.EvltAP..VHFpgGKAAD...V
  154-  180 (35.84/14.17)	FPW..TGNNPED.T..lTEALVKV..G.ISNKPQI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.51|      12|      37|     319|     330|       2
---------------------------------------------------------------------------
  319-  330 (21.67/12.75)	EQFLDSILSGIG
  357-  368 (24.84/15.50)	DHFLDWILHSLG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13955 with Med12 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ELPVSSSFPYQPTANLPVPPRPGSVHLGDISNQRRIVPGGSGVKEYPNLQAPEVLTAP
2) MTSRPGPGIHEQSRGSGVPSRNPNPQVRRRPSKPLNTALPPPDCIDPALDGDRASAYNGAAEPPRPLPRGRPQLFYGNAPSD
85
1
142
82










Molecular Recognition Features






MoRF SequenceStartStop




1) RPQLFY
71
76