<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13949
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDDVLQAQFDRVEQALGTLVDSIASYNPNPQAAIDLVAADDELSHGLDQLARHQANHARLQALRAEADALEEQLKSSVAALAGLRRELSETPATVFPASSRPVPFDELLQYAKSISKYTVPPTFRERALDADGDNAKDKEAIEPPASAPATNGLNTPTTAIALAEPPATDGAEATAEGETASNVVPEITAEEEEWLQKLKDSGFAWFPWPDADKIRRGNLWKLYHYREQGRDLDAFDIEAYEEEERKKFSDEPLVPEQPVEERPAEIPVQDQRPQQPPPAQAAPPRAGFTLFDDMESDED |
| Length | 300 |
| Position | Middle |
| Organism | Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Epicoccum.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.685 |
| Instability index | 61.64 |
| Isoelectric point | 4.35 |
| Molecular weight | 33064.90 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13949
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.43| 19| 22| 48| 66| 1
---------------------------------------------------------------------------
48- 66 (32.12/18.05) DQLARH.QANHARLQALRAE
68- 87 (25.32/12.99) DALEEQlKSSVAALAGLRRE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.22| 26| 178| 13| 46| 6
---------------------------------------------------------------------------
13- 46 (39.18/34.44) EQALGTLVDSIASYNPNPQAaidlvaadDELSHG
193- 218 (52.04/29.25) EEWLQKLKDSGFAWFPWPDA........DKIRRG
---------------------------------------------------------------------------
|