Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDDVLQAQFDRVEQALGTLVDSIASYNPNPQAAIDLVAADDELSHGLDQLARHQANHARLQALRAEADALEEQLKSSVAALAGLRRELSETPATVFPASSRPVPFDELLQYAKSISKYTVPPTFRERALDADGDNAKDKEAIEPPASAPATNGLNTPTTAIALAEPPATDGAEATAEGETASNVVPEITAEEEEWLQKLKDSGFAWFPWPDADKIRRGNLWKLYHYREQGRDLDAFDIEAYEEEERKKFSDEPLVPEQPVEERPAEIPVQDQRPQQPPPAQAAPPRAGFTLFDDMESDED |
Length | 300 |
Position | Middle |
Organism | Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Epicoccum. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.685 |
Instability index | 61.64 |
Isoelectric point | 4.35 |
Molecular weight | 33064.90 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13949 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.43| 19| 22| 48| 66| 1 --------------------------------------------------------------------------- 48- 66 (32.12/18.05) DQLARH.QANHARLQALRAE 68- 87 (25.32/12.99) DALEEQlKSSVAALAGLRRE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.22| 26| 178| 13| 46| 6 --------------------------------------------------------------------------- 13- 46 (39.18/34.44) EQALGTLVDSIASYNPNPQAaidlvaadDELSHG 193- 218 (52.04/29.25) EEWLQKLKDSGFAWFPWPDA........DKIRRG --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LWKLYHYR 2) PRAGFTLFDDMESDED 3) VEERPAEIPVQDQR | 220 285 260 | 227 300 273 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab