<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13948
| Description |
Uncharacterized protein |
| Sequence | MDKLRRDMDMAASRGTAVDWPQIQRTTTSVNQFITGLNTTINGGRKHIAESRKTDAGKVLRNKQGDEEYRYNDIAIPSQADTIRNLHPFPISPFPGTNEHLSGLTQTLLRKRLEPTEEKWVEDRLAKALEFAYVPPEWGIEPRKPAEKECKDSDTESGDIKPDNDGKPKTAFEKYNKRSKGTLTEDELVEKWNDAHASFFDPPETYQGDSGEEGEEEEEEEEEFEDAMDEDEPAQAAQEEEAKPKTPPPVVVIQEAEPPVHKPVPGMPVLDIGVSLKFIATGQL |
| Length | 284 |
| Position | Head |
| Organism | Epicoccum nigrum (Soil fungus) (Epicoccum purpurascens) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Didymellaceae> Epicoccum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.987 |
| Instability index | 60.13 |
| Isoelectric point | 4.65 |
| Molecular weight | 31927.92 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13948
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.92| 15| 15| 209| 223| 1
---------------------------------------------------------------------------
209- 223 (24.49/12.22) DSGEEGEEEEEEEEE
226- 240 (25.43/12.96) DAMDEDEPAQAAQEE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.70| 15| 17| 109| 124| 2
---------------------------------------------------------------------------
118- 137 (20.72/16.26) EKWvEDRLAKALEfayvPPE
190- 204 (29.98/19.48) EKW.NDAHASFFD....PPE
---------------------------------------------------------------------------
|