<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13940
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSQSEPNPDLRAANRARFELELEFVQSLANPYYLHSLAQQGILNQPAFVNFLKYLMYWKEKDYARFILYPHALHHLELLQQAQFRSEIGKDEWREYLNQKQFDHWRTWRDPSRIQAAAALPTDSQPQSASSEAHIIPHANGS |
Length | 142 |
Position | Middle |
Organism | Trametes coccinea BRFM310 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Trametes.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.694 |
Instability index | 56.06 |
Isoelectric point | 6.37 |
Molecular weight | 16680.47 |
Publications | PubMed=26692083
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13940
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 25.17| 8| 22| 24| 34| 3
---------------------------------------------------------------------------
24- 34 ( 9.61/13.07) FVQSLAnpyYL
48- 55 (15.56/ 7.69) FVNFLK...YL
---------------------------------------------------------------------------
|