<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13933
Description |
Kinase-like protein |
Sequence | MMNEYPGTSGNILLDDPMRIYRAKRDAARKRVTDKYAILGFISSGTYGRVYKAQSKDSDGRIHAIKKFKPDKEGELATYTGISQSAIREIALNREISHENIVALKEVILEDKSIYMVFEYAEHDFLQVIHHHSQTLRSSISQPVLKSLTYQLLNGLLYLHDAHIIHRDLKPANILITSSGVVKIGDLGLARLTHQPLQPLCAGDKVVVTIWYRAPELLLGAKHYNKAVDIWAVGCVMAELASLRPIFKGEEAKLDSKKNVPFQKDQLLKIFEVLGTPSERDWPKIKEMPEYMSMKKLDHYNNRLSEWCQSRIRSHGADLLAHLFAYDPDKRLTAAEALQHRWFHEEPRPTRNAFASLPSHQIPPHRRITQDDAPSMMPMAAVGSQIQAQVSQVQATAQAHLSQLSHSHSNASKVGSAASFASLSGGAGGGGPHTRKKARLG |
Length | 441 |
Position | Kinase |
Organism | Trametes coccinea BRFM310 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Trametes.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.385 |
Instability index | 43.92 |
Isoelectric point | 9.38 |
Molecular weight | 49281.90 |
Publications | PubMed=26692083
|
Function
Annotated function |
|
GO - Cellular Component | euchromatin GO:0000791 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
cyclin-dependent protein serine/threonine kinase activity GO:0004693 IEA:EnsemblFungi
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP13933
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.75| 16| 17| 313| 328| 1
---------------------------------------------------------------------------
313- 328 (29.59/17.34) RSHGADLLAH.LFAYDP
331- 347 (26.16/14.60) RLTAAEALQHrWFHEEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.32| 16| 23| 243| 258| 3
---------------------------------------------------------------------------
243- 258 (27.02/19.61) LRPIFK..GEEAKLDSKK
267- 284 (25.30/17.88) LLKIFEvlGTPSERDWPK
---------------------------------------------------------------------------
|