<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13931
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MTSHAYEVALFGEFFAHDLPAILNRFTLHSESAHQMHAREVVFEPFDAQYQRDSGTEPVLLRARKELLEPDSKWLLYSYLKPESVRVHPEATVRPWATCQVVGEALEFASALGYVRRSQIYKRGYVFRRGNLVIQMFQQEHADPKTGKPIPAHPDTLWEVEVKTAAPVRNTQETPLSQSLDAVLEVQLLMKGLLDLRRQDV |
Length | 201 |
Position | Head |
Organism | Trametes coccinea BRFM310 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Polyporales> Polyporaceae> Trametes.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.352 |
Instability index | 44.35 |
Isoelectric point | 6.24 |
Molecular weight | 23054.02 |
Publications | PubMed=26692083
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13931
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.80| 22| 23| 36| 58| 1
---------------------------------------------------------------------------
36- 58 (36.32/32.57) MHAREVVFEPfDAQYQRDSGTEP
61- 82 (35.48/25.40) LRARKELLEP.DSKWLLYSYLKP
---------------------------------------------------------------------------
|