<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13928

Description Mediator of RNA polymerase II transcription subunit 10 (Fragment)
SequenceMSGRRSNPSTPALGTAPTTTPGLKPLPLPGTLNLSALRASSNPPSATTSPTSPTSPLSPPPPKPNANANANANANANAAAPLDPKLPAVESPPNQSRHTLEPALHLIHQALHTTELIARETFNFSDTSLPVLADHLSDFTSVLAELDALAADPSSDLNKIWIPKPVLEAIDRGENPRQATMVAMDRTAAENQYLHGKVWAAGEFARAMEDELANEFADEMREVQEYLSKEGK
Length232
PositionMiddle
OrganismCatenaria anguillulae PL171
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Blastocladiomycota> Blastocladiomycota incertae sedis> Blastocladiomycetes> Blastocladiales> Catenariaceae> Catenaria.
Aromaticity0.04
Grand average of hydropathy-0.470
Instability index42.41
Isoelectric point5.12
Molecular weight24672.28
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364146

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13928
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     145.46|      30|      30|      33|      62|       1
---------------------------------------------------------------------------
    1-   27 (43.60/14.21)	.MSGRRSNPSTPALGTAPT..TTPGLKPLP
   33-   62 (54.48/19.40)	NLSALRASSNPPSATTSPTSPTSPLSPPPP
   65-   93 (47.39/16.02)	NANA.NANANANANAAAPLDPKLPAVESPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.67|      12|      27|      94|     106|       2
---------------------------------------------------------------------------
   94-  106 (18.84/15.69)	NQSRHTLePAL..HL
  123-  136 (17.83/ 9.40)	NFSDTSL.PVLadHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.64|      16|      35|     146|     161|       3
---------------------------------------------------------------------------
  146-  161 (27.57/15.49)	LDALAADPSSDLNKIW
  184-  199 (29.07/16.66)	MDRTAAENQYLHGKVW
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13928 with Med10 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MSGRRSNPSTPALGTAPTTTPGLKPLPLPGTLNLSALRASSNPPSATTSPTSPTSPLSPPPPKPNANANANANANANAAAPLDPKLPAVESPPNQSRHTLEPALHL
1
106










Molecular Recognition Features






MoRF SequenceStartStop




NANANA