<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13928
| Description |
Mediator of RNA polymerase II transcription subunit 10 (Fragment) |
| Sequence | MSGRRSNPSTPALGTAPTTTPGLKPLPLPGTLNLSALRASSNPPSATTSPTSPTSPLSPPPPKPNANANANANANANAAAPLDPKLPAVESPPNQSRHTLEPALHLIHQALHTTELIARETFNFSDTSLPVLADHLSDFTSVLAELDALAADPSSDLNKIWIPKPVLEAIDRGENPRQATMVAMDRTAAENQYLHGKVWAAGEFARAMEDELANEFADEMREVQEYLSKEGK |
| Length | 232 |
| Position | Middle |
| Organism | Catenaria anguillulae PL171 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Blastocladiomycota>
Blastocladiomycota incertae sedis> Blastocladiomycetes> Blastocladiales>
Catenariaceae> Catenaria.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.470 |
| Instability index | 42.41 |
| Isoelectric point | 5.12 |
| Molecular weight | 24672.28 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13928
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 145.46| 30| 30| 33| 62| 1
---------------------------------------------------------------------------
1- 27 (43.60/14.21) .MSGRRSNPSTPALGTAPT..TTPGLKPLP
33- 62 (54.48/19.40) NLSALRASSNPPSATTSPTSPTSPLSPPPP
65- 93 (47.39/16.02) NANA.NANANANANAAAPLDPKLPAVESPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.67| 12| 27| 94| 106| 2
---------------------------------------------------------------------------
94- 106 (18.84/15.69) NQSRHTLePAL..HL
123- 136 (17.83/ 9.40) NFSDTSL.PVLadHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.64| 16| 35| 146| 161| 3
---------------------------------------------------------------------------
146- 161 (27.57/15.49) LDALAADPSSDLNKIW
184- 199 (29.07/16.66) MDRTAAENQYLHGKVW
---------------------------------------------------------------------------
|