<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13921
| Description |
Kinase-like domain-containing protein |
| Sequence | MTEYKSKRDSCRQKIASKYDILGFISSGTYGRVYKAKSKNKAGRQTQEPDSPMTLPDDGKEYAIKKFKPDKEGEAATYIGISQSACREIALCRELHHENIVGLQEVLLEDKSIHMVFEYAEHDLLQIIGFHSHPERKYMSEYTIKSFLWQLLNGVAYLHANWVMHRDLKPANILVTANGVVKVGDLGLARLFYKPLQPLFHGDKVVVTIWYRAPELLLGSRHYTKAIDIWAIGCIFAELITLRPIFKGEEAKVENKKTVPFQKNQLQKIFDILGNPTKERWPTIDQQPEYPNLASFRQTPNVLRSMYQTWPIKSEQGCNLLAAMLEYDPLKRITAEEALNHPYFQEDPKPGME |
| Length | 353 |
| Position | Kinase |
| Organism | Lobosporangium transversale |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mortierellomycotina>
Mortierellomycetes> Mortierellales> Mortierellaceae> Lobosporangium.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.457 |
| Instability index | 46.50 |
| Isoelectric point | 8.57 |
| Molecular weight | 40604.30 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13921
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.86| 17| 27| 242| 265| 1
---------------------------------------------------------------------------
242- 259 (24.82/22.89) LRPIFK..GEEAKvENKKTV
266- 284 (28.04/ 8.84) LQKIFDilGNPTK.ERWPTI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.52| 18| 25| 153| 174| 2
---------------------------------------------------------------------------
153- 170 (34.95/24.17) NG...VAYLHANWVMHRDLKP
178- 198 (27.57/10.11) NGvvkVGDLGLARLFYKPLQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.39| 10| 29| 4| 13| 4
---------------------------------------------------------------------------
4- 13 (20.28/15.31) Y..KSKRDSCRQ
34- 45 (14.11/ 8.53) YkaKSKNKAGRQ
---------------------------------------------------------------------------
|