Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MNTPFPQTEVNIEALENVKTRLFQLQESILFFLRSINPETTPGTVSWTELHSKFNVLIAKYLHLTNLVNDPHNTLLQSYTVFPNEAPATDQHVQNLSVLLRTKLLPELEQEAEDRIKEGTIPGLNSQGGGVAEDRKVLQALKLKVTMHDALCQAADEIFENQRDMINTRVRYESDDEGQGDINSKTTQRSGDKMKEPSSNSNTVPPVDDFAIGMVDNATSIRYMSEWGGTLHDVDGYTSDESADEAAITGIPKNGIDLDDSYFEARRQDFSSGDEESSQSDMESVQDDQGSEDIQEDEDKDEEEEEEEEEEEDDEDTFMEVRTGSQPIDVDSGPSSMQMAEDVFHEDAGNSGDEEEMEEVM |
Length | 361 |
Position | Head |
Organism | Lobosporangium transversale |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Mucoromycota> Mortierellomycotina> Mortierellomycetes> Mortierellales> Mortierellaceae> Lobosporangium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.846 |
Instability index | 57.21 |
Isoelectric point | 4.06 |
Molecular weight | 40465.24 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13903 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.41| 16| 17| 160| 176| 2 --------------------------------------------------------------------------- 160- 176 (24.59/23.23) ENQRDmINTRVRYESDD 177- 192 (28.82/20.87) EGQGD.INSKTTQRSGD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 61.64| 16| 17| 100| 115| 3 --------------------------------------------------------------------------- 100- 115 (24.19/14.72) LRTKLLPELEQE....AEDR 116- 135 (18.87/ 9.99) IKEGTIPGLNSQgggvAEDR 143- 157 (18.58/ 9.73) LKVTMHDALCQA....ADE. --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 76.68| 24| 42| 288| 316| 5 --------------------------------------------------------------------------- 288- 311 (42.25/20.41) DQGSEDIQ..ED...EDKDEEEEEEEEEE 331- 359 (34.43/ 8.63) DSGPSSMQmaEDvfhEDAGNSGDEEEMEE --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 51.59| 16| 17| 57| 72| 6 --------------------------------------------------------------------------- 57- 72 (27.95/18.00) LIAKYLHLTNL..VNDPH 75- 92 (23.64/14.28) LLQSYTVFPNEapATDQH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AAITGIPKNGIDLDDSYFEARRQDFS 2) EDTFMEVRTGSQPIDVDSGPSSMQMAEDVFHEDAGNSGDEEEMEEVM | 246 315 | 271 361 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab