<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13899
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAIPAAPSLNPAQAALIPSPSLPLAPQLTHLLTQFTELSLQLFSLLSASTPSASAGTAAIYDELAKLDEKLAGLMAMVEEHQRRWRRIEKLVGEVKATEEGWKKGVQGMHEALAQLQPIITSGAVDRAAILASSSSTLTPQTILSYARLLAPFTSAPPSSLFPPDQQLTGPGAQAMDPSGRTLPMGAIPPFPTEAAMRRGRLQFGAGVDGEEGLVGERGEVGARKDPTAQPPADSLPPRQDPAARLAQHARQEQQQRKAAQQQQQQAEEEEFVFDLDLNPDL |
| Length | 282 |
| Position | Middle |
| Organism | Leucosporidium creatinivorum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Leucosporidiales> Leucosporidium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.327 |
| Instability index | 62.73 |
| Isoelectric point | 5.12 |
| Molecular weight | 30141.80 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13899
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.63| 14| 16| 74| 87| 1
---------------------------------------------------------------------------
74- 87 (25.59/20.54) LMAMVEEHQRRWRR
91- 104 (23.04/17.82) LVGEVKATEEGWKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.84| 16| 16| 194| 209| 2
---------------------------------------------------------------------------
194- 209 (28.12/16.53) EAAMRRGRLQFGAGVD
211- 226 (24.72/13.72) EEGLVGERGEVGARKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.07| 16| 16| 121| 136| 3
---------------------------------------------------------------------------
121- 136 (24.62/13.36) TSGAV.DRAAILASSSS
139- 155 (23.45/12.43) TPQTIlSYARLLAPFTS
---------------------------------------------------------------------------
|