Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MAIPAAPSLNPAQAALIPSPSLPLAPQLTHLLTQFTELSLQLFSLLSASTPSASAGTAAIYDELAKLDEKLAGLMAMVEEHQRRWRRIEKLVGEVKATEEGWKKGVQGMHEALAQLQPIITSGAVDRAAILASSSSTLTPQTILSYARLLAPFTSAPPSSLFPPDQQLTGPGAQAMDPSGRTLPMGAIPPFPTEAAMRRGRLQFGAGVDGEEGLVGERGEVGARKDPTAQPPADSLPPRQDPAARLAQHARQEQQQRKAAQQQQQQAEEEEFVFDLDLNPDL |
Length | 282 |
Position | Middle |
Organism | Leucosporidium creatinivorum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Microbotryomycetes> Leucosporidiales> Leucosporidium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.327 |
Instability index | 62.73 |
Isoelectric point | 5.12 |
Molecular weight | 30141.80 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13899 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.63| 14| 16| 74| 87| 1 --------------------------------------------------------------------------- 74- 87 (25.59/20.54) LMAMVEEHQRRWRR 91- 104 (23.04/17.82) LVGEVKATEEGWKK --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 52.84| 16| 16| 194| 209| 2 --------------------------------------------------------------------------- 194- 209 (28.12/16.53) EAAMRRGRLQFGAGVD 211- 226 (24.72/13.72) EEGLVGERGEVGARKD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.07| 16| 16| 121| 136| 3 --------------------------------------------------------------------------- 121- 136 (24.62/13.36) TSGAV.DRAAILASSSS 139- 155 (23.45/12.43) TPQTIlSYARLLAPFTS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EEEEFVFDLDLNPDL 2) QDPAARLAQHARQEQQQRKAAQQ | 268 240 | 282 262 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab