Description | Mediator of RNA polymerase II transcription subunit 31 (Fragment) |
Sequence | SKFEQELAFVQSLASPAYLRHLAETSLLHDQALVAYLAYLRYWQSPEYARFISYPASLLHLELLQNPAFRADLINESVSKQLNDALYFDWL |
Length | 91 |
Position | Middle |
Organism | Protomyces lactucaedebilis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Taphrinomycetes> Taphrinales> Protomycetaceae> Protomyces. |
Aromaticity | 0.15 |
Grand average of hydropathy | -0.016 |
Instability index | 59.80 |
Isoelectric point | 5.13 |
Molecular weight | 10593.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13892 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 88.88| 18| 19| 4| 21| 1 --------------------------------------------------------------------------- 4- 21 (31.14/15.23) EQELAFVQSL.ASPAYLRH 24- 42 (25.82/11.71) ETSLLHDQALvAYLAYLRY 43- 60 (31.92/15.74) WQSPEYARFI.SYPASLLH --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NDALYFDWL 2) YLAYLRYW | 83 36 | 91 43 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab