<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13878
| Description |
Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MDLLGAYASSNEDDDAMEEVVQEPSSAAPQPSKQERAGAQEGTQAAEEQEESKEGQDTIAGKRIAELNEVEESIAQLLHLAGCTLASLHPDPMSSFTSRTMSLDDDESEEGSPRPRPPPAPPGEEDKGADFAKYAEAYYTTLNDIQLSLRTSIRHLRLSRASPAPLLDPHFASLANTTSEGVVGSGGLALGDRLKPLTLEEPRWPGGGEEAPPKLSVGALKLEKEAWEALGAALGGGE |
| Length | 238 |
| Position | Head |
| Organism | Leucosporidium creatinivorum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Microbotryomycetes> Leucosporidiales> Leucosporidium.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.618 |
| Instability index | 59.69 |
| Isoelectric point | 4.43 |
| Molecular weight | 25200.39 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13878
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.62| 18| 18| 35| 52| 1
---------------------------------------------------------------------------
35- 52 (30.66/14.21) ERAGAQEGTQAAE..EQEES
54- 73 (22.96/ 9.16) EGQDTIAGKRIAElnEVEES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 214.20| 48| 88| 75| 122| 2
---------------------------------------------------------------------------
2- 32 (31.15/ 9.27) ................DLLGAYAS.S..NEDDDAMEEVVQEPSSaA....PQPS
75- 122 (86.73/35.61) AQLLHLAGCTLASLHPDPMSSFTS.RTMSLDDDESEEGSPRPRP.P....PAPP
129- 165 (43.71/15.23) ADFAKYAEAYYTTLNDIQLSLRTSiRHLRLS.....RASPAP............
170- 213 (52.60/19.44) ....HFA..SLANTTSEGVVG..S.GGLALGDRLKPLTLEEPRW.PgggeEAPP
---------------------------------------------------------------------------
|