<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13875
Description |
Kinase-like domain-containing protein |
Sequence | MERYFARKNKAHVKVLDKYVILGFISSGTYGKVYKAKSSFLDDEREYAIKKFKPDRDGQAVAYTGLSQSAIREMALCRELRHENLVNLHEIILEDKCIYMVFEYAEYDLLQIIHYHVHQPKPQQKIHDAAVRSIMAQLIQGVDFLHKNWVMHRDLKPANIMINKNGQVKCGDLGLARLFFTPLQPFWAGDKVVVTIWYRAPELLLGAKHYGPAIDMWAIGCIFAELLVLRPLFKGDEAKVDNKKQVPFQREQLKKIIDMLGKPTPERWPDVVNMPEYNQLKTFRAQHYANQLPNWYNLIGPMAASQEGLKLLMSLLEYDPTKRLSAEDALKHPYFQEMPKYTSNAFEGTGVIYPNRQIRADDTDMSHVVPVKKVTTTANQASSSVAGKRGHDTVGGTTSGAKRAK |
Length | 405 |
Position | Kinase |
Organism | Protomyces lactucaedebilis |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Taphrinomycotina> Taphrinomycetes>
Taphrinales> Protomycetaceae> Protomyces.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.388 |
Instability index | 38.15 |
Isoelectric point | 9.26 |
Molecular weight | 46267.98 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP13875
No repeats found
|