<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13870
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MAGAPPPLDETQWRDPHTAASMQGIHSNSVLHYFAASPFSDPTSNNAVIITQSQWNRDMHQYLVTRDAFEGRLKTMSGLEYIVAQEPSVMGPGAGTGVWVIRKQTRRKRANEEDEITVHSSYFVVGDNIYMAPTLADIMSYRMATVESKLRKCFPVASEVSTWSPAAGHAYTIPTTSSNPRERTSTSKEATPMPDGESHTSKAAGVSESKKPGQSTMLDARLAEQSFTIHMQYGSEYMDENPITGKPGEFHLSSTGRKDRMVQAPGNMPSLTTSFKSPTVPDLGGKRDVTGKGDKTPKTPTSGPGSKPKRKKSKAGTTPGTTPTAS |
| Length | 326 |
| Position | Head |
| Organism | Pseudomassariella vexata |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Pseudomassariaceae> Pseudomassariella.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.700 |
| Instability index | 43.63 |
| Isoelectric point | 9.23 |
| Molecular weight | 35299.17 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13870
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 163.16| 36| 36| 142| 177| 1
---------------------------------------------------------------------------
72- 99 (40.21/21.28) ..........................................RLKTM.SGLE..YIVAQEPSVMGPGAGTGVW
100- 172 (40.69/21.62) VIRKQtrrkraneedeitvhssyfvvgdniymaptladimsyRMATVESKLRKCFPVASEVSTWSPAAGHAYT
173- 209 (45.33/24.89) IPTTS..................................snpRERTSTSK..EATPMPDGESHTSKAAGVSES
211- 246 (36.93/18.98) KPGQS................................tmldaRLA..EQSFTIHMQYGSEYMDENPITGK...
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.48| 13| 16| 292| 304| 2
---------------------------------------------------------------------------
292- 304 (24.70/10.18) KGDKTPKTPTSGP
311- 323 (22.79/ 8.90) KKSKAGTTPGTTP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.30| 16| 16| 247| 262| 3
---------------------------------------------------------------------------
247- 262 (29.11/14.95) PGEFHLSSTGRKDRMV
265- 280 (29.19/15.01) PGNMPSLTTSFKSPTV
---------------------------------------------------------------------------
|