<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13864
| Description |
Kinase-like domain-containing protein |
| Sequence | MSLTNPPSGASAPSGARTQGLKRSVQAAFDDPNDRGIGKGYQTKVRIIDKYKIIGFISSGTYGRVYKAIGRQGQTGEFAIKKFKPDKEGEQIQYTGISQSAVREMALCSELSNPNVIRLVEIILEDKCIFMVFEYAEHDLLQIIHHHTQNPRHHIPPATVKSIMFQLLNGCQYLHANWVLHRDLKPANIMVTSTGQVKIGDLGLARLFHKPLHSLYSGDKVVVTIWYRAPELLLGSRHYTPAIDMWAIGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPYLTSMHEYSALGTLQAPMMAHHHHGGGGHHRNSHAAATAASTSHLEKWYYSTIGAHSSTSAPSSSTSLASLGAEGYKLLAGLLEYDPEKRLTAQQALQHPFFSTGDKVSNNCFEGLKTSYPQRRVSQDDNDIRTSSLPGTKRSGLPDDSLVRPVKRVKEG |
| Length | 458 |
| Position | Kinase |
| Organism | Pseudomassariella vexata |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Pseudomassariaceae> Pseudomassariella.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.399 |
| Instability index | 34.95 |
| Isoelectric point | 9.35 |
| Molecular weight | 50869.52 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13864
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.82| 10| 182| 145| 154| 2
---------------------------------------------------------------------------
145- 154 (23.08/10.54) HHHTQNPRHH
319- 328 (23.73/11.00) HHHHGGGGHH
---------------------------------------------------------------------------
|