Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDIQVDLRFDRVDKALTNLIDSIVKYNTSAHQGNELVIADNELSKGLEDVQKHQQNYARLENLRSITKSLDTQIKETLTLLAQTRKELSSTTATVYPSGSHYPIDYSELLTVARRISSTTLPRQSVLDKYRAEQAQQALAAEQADKVQQSGGAETTATTPASTPQANGVAVVNGPASQPSQADPSSQQITTSAGTNLPEHLIAHLNPRASEEFIPWPSEQHVRRGALAELAHLAAQGIAAEGYDPAEEAARKLREEEEAKAKEEKERLEREEAERKMREQRERARKEAAERAEKEAANWRRGSVVGGPASAGLSAGGAAAAGEKKQFQFMDDDDESD |
Length | 337 |
Position | Middle |
Organism | Pseudomassariella vexata |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Pseudomassariaceae> Pseudomassariella. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.792 |
Instability index | 40.39 |
Isoelectric point | 5.20 |
Molecular weight | 36866.14 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13850 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 48.74| 15| 27| 247| 273| 1 --------------------------------------------------------------------------- 258- 272 (23.53/22.23) EAKAKEEKERLEREE 274- 288 (25.21/ 7.26) ERKMREQRERARKEA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 114.80| 29| 30| 184| 213| 2 --------------------------------------------------------------------------- 158- 180 (31.36/18.57) ......TTPAST.PQANGVAVVNGP..ASQPS 184- 213 (47.34/37.39) PSSQQITTSAGTnLPEHLIAHLNPR..ASEEF 217- 243 (36.10/22.57) PSEQHVRRGA...LAE..LAHLAAQgiAAEGY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 36.18| 12| 26| 80| 92| 3 --------------------------------------------------------------------------- 80- 92 (15.92/13.61) LLAQTRKeLSSTT 109- 120 (20.26/12.08) LLTVARR.ISSTT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) AEKEAANWRRGSVVGG 2) LSAGGAAAAGEKKQFQFMDDDDES | 292 313 | 307 336 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab