<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13850
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDIQVDLRFDRVDKALTNLIDSIVKYNTSAHQGNELVIADNELSKGLEDVQKHQQNYARLENLRSITKSLDTQIKETLTLLAQTRKELSSTTATVYPSGSHYPIDYSELLTVARRISSTTLPRQSVLDKYRAEQAQQALAAEQADKVQQSGGAETTATTPASTPQANGVAVVNGPASQPSQADPSSQQITTSAGTNLPEHLIAHLNPRASEEFIPWPSEQHVRRGALAELAHLAAQGIAAEGYDPAEEAARKLREEEEAKAKEEKERLEREEAERKMREQRERARKEAAERAEKEAANWRRGSVVGGPASAGLSAGGAAAAGEKKQFQFMDDDDESD |
| Length | 337 |
| Position | Middle |
| Organism | Pseudomassariella vexata |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Pseudomassariaceae> Pseudomassariella.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.792 |
| Instability index | 40.39 |
| Isoelectric point | 5.20 |
| Molecular weight | 36866.14 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13850
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.74| 15| 27| 247| 273| 1
---------------------------------------------------------------------------
258- 272 (23.53/22.23) EAKAKEEKERLEREE
274- 288 (25.21/ 7.26) ERKMREQRERARKEA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 114.80| 29| 30| 184| 213| 2
---------------------------------------------------------------------------
158- 180 (31.36/18.57) ......TTPAST.PQANGVAVVNGP..ASQPS
184- 213 (47.34/37.39) PSSQQITTSAGTnLPEHLIAHLNPR..ASEEF
217- 243 (36.10/22.57) PSEQHVRRGA...LAE..LAHLAAQgiAAEGY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.18| 12| 26| 80| 92| 3
---------------------------------------------------------------------------
80- 92 (15.92/13.61) LLAQTRKeLSSTT
109- 120 (20.26/12.08) LLTVARR.ISSTT
---------------------------------------------------------------------------
|