<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13832
| Description |
Pkinase-domain-containing protein |
| Sequence | MQQQQHQQLQQQQQHQQQHQQLSDGRPSISAKYKSLGFIAAGTYGRVFKANRRNQDSRPLLEYAIKKFKPEKEGDASLQAGISQSACREIALCRELSHVNVVFLEEVFVDAIDRSIYMVFEYAEHDLLQILHHHSQLQPPLRAIPAFTIKSLLWQLINGVAYLHANWVLHRDLKPANVLVNSQGVVKIGDLGLARIFQKPLRPLYDGDKVVVTIWYRSPELLFSSKHYTTAVDMWAVGCIFAELLMLRPIFKGEEAKMDGKKNQIPFQRDQVQKIIDVLGTPTIEKWPSLQYMQDYPQLRQFGPGEYTLRQVCQQTLSQVTEQGFQLLSGTFEYDPIKRLSADDALKHPYFMEDPLPSMYAFIPGWKVQYPIRRLQPADDFK |
| Length | 382 |
| Position | Kinase |
| Organism | Rhizoclosmatium globosum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Chytridiomycetes> Chytridiales>
Chytriomycetaceae> Rhizoclosmatium.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.380 |
| Instability index | 49.88 |
| Isoelectric point | 8.67 |
| Molecular weight | 44096.16 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13832
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.93| 19| 34| 325| 344| 1
---------------------------------------------------------------------------
325- 344 (30.89/23.86) FQLLSG.TFEYdPIKRLS.ADD
360- 380 (28.04/16.26) YAFIPGwKVQY.PIRRLQpADD
---------------------------------------------------------------------------
|