<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13817
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MSLVPPHLPSPAATPDEHLATQAAVSVDSEQRQAQIRAEVEAQLLRLSQDLYEMEICAGEVGMGMEERVPRYMMEVSEALVRLEELSGRMEDSVPKQILEYNRAVDQHRNPHVYTKSTLTRAAGENQYALGRMLGLENFRRQLQSALAEEFPSVDLPDRRHVPDWERNAGQIKENGEVDLKENGESGVRENGESGVRENGESEVKENGESGGEHNGESEIKVEDGDTVPNGQVEGHVFVQNESLELTPTTTPANGSL |
| Length | 257 |
| Position | Middle |
| Organism | Naematelia encephala |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Tremellomycetes>
Tremellales> Naemateliaceae> Naematelia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.775 |
| Instability index | 41.01 |
| Isoelectric point | 4.60 |
| Molecular weight | 28426.92 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13817
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 77.11| 15| 15| 181| 195| 1
---------------------------------------------------------------------------
166- 179 (18.49/ 6.39) .ERNAGQIKENGEVD
181- 195 (28.77/13.23) KENGESGVRENGESG
197- 211 (29.85/13.94) RENGESEVKENGESG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.99| 20| 22| 60| 79| 2
---------------------------------------------------------------------------
60- 79 (36.34/25.00) EVGMGMEERVPRYMMEVSEA
85- 104 (34.66/23.51) ELSGRMEDSVPKQILEYNRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.08| 20| 22| 212| 231| 3
---------------------------------------------------------------------------
212- 231 (34.77/23.80) GEHNGESE.IKVEDGDTVPNG
235- 255 (30.31/19.83) GHVFVQNEsLELTPTTTPANG
---------------------------------------------------------------------------
|