<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13809
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MNPNAISNLKAEDISMLETLRARLMPLAYNLQQLQNEIAASPDGTLKWPTIQRQSALLNSHLSTIQKLIADKEKKTVEVLSSLYPYPMPPFPIEQMEGLSSTLTRKKPEPGDENWILERLRKAAEFCDGAEELGLDVVVKKEGDGDKDVNMKDEDEDGDGDDEDDGENGVSGRKGPGAGIKRVKTTLSQEDITYLWENANDWVTGQMAKVVGGEGSDASGSEGSSPASDTGDGEIKKRMEGQPGASAATALAQRTAPAMSLGAVLKFMETGEGS |
| Length | 274 |
| Position | Head |
| Organism | Clohesyomyces aquaticus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Lindgomycetaceae> Clohesyomyces.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.637 |
| Instability index | 39.28 |
| Isoelectric point | 4.54 |
| Molecular weight | 29456.51 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13809
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 117.80| 30| 31| 128| 157| 1
---------------------------------------------------------------------------
97- 126 (29.75/15.45) ....EGLSSTLTRKKPEPGD..ENwilERLRKAAEF
128- 157 (48.72/29.98) DG.AEELGLDVVVKKEGDGD..KD...VNMKDEDED
159- 191 (39.33/22.79) DGdDEDDGENGVSGRKGPGAgiKR...VKTTLSQED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.13| 12| 26| 233| 244| 3
---------------------------------------------------------------------------
233- 244 (22.69/15.01) GEIKKRMEGQPG
262- 273 (21.44/13.81) GAVLKFMETGEG
---------------------------------------------------------------------------
|