Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELLLFGQVPQSRHEQVLKILAGVAAMQPRAVLERHLVYKPQREPEEPGSHLRRGGTQAIAMKTKAPATARDLYFSQLVNSLTRDDFDRDADEQAEAFVATGESAADAKWSYQFHETPDTGDRGVLVRLAHNTELLSGDPHSYMVHLGNQYVSEYYLEGHRFVHDNIIVLLHRVLHESGVRPAPGVSPNTALPSFDSLRPLDPSGGYVLEAKIRVQDLNNPNVLDAGIEELKRLKSQMKGCVELNVPDRLLLDTRVKYKPNLGPSAGARPAVAPR |
Length | 276 |
Position | Head |
Organism | Clohesyomyces aquaticus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Lindgomycetaceae> Clohesyomyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.441 |
Instability index | 41.24 |
Isoelectric point | 6.46 |
Molecular weight | 30657.37 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13798 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 57.34| 16| 217| 31| 46| 1 --------------------------------------------------------------------------- 31- 46 (28.89/19.26) RAVLERHLVYKPQREP 250- 265 (28.45/18.86) RLLLDTRVKYKPNLGP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) ARPAV 2) VKYKPNL | 269 257 | 273 263 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab