<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13781
Description |
SURF5-domain-containing protein |
Sequence | MATTSNKPAPTGNVSTNALTQIEETYNKRLDNELDQLVDSFGDIIRVAKIQDKDKFRIAQENYQVECRAANIVRSVESLLGLVTELKQSLLLNDTNTLNHFTTSRIRVVSNQKEVVKDSVVKLRGNLDSAIWEMENAYYNSRYIS |
Length | 145 |
Position | Head |
Organism | Basidiobolus meristosporus CBS 931.73 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota>
Entomophthoromycotina> Basidiobolomycetes> Basidiobolales> Basidiobolaceae>
Basidiobolus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.477 |
Instability index | 37.23 |
Isoelectric point | 5.87 |
Molecular weight | 16455.31 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13781
No repeats found
|