Description | Uncharacterized protein |
Sequence | MDRLTQLQDSIDQLALMFVSSVDYLQGKSAMVTSNPEFPVTKANERADPPDVFKKSTRELAADICKHAKQIDTLVEALPGIKHTEADQIRLLETLDQENAVVCAQYEEQLVRAKTLLKEVTDTLRVITDDQSQS |
Length | 134 |
Position | Middle |
Organism | Basidiobolus meristosporus CBS 931.73 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Entomophthoromycotina> Basidiobolomycetes> Basidiobolales> Basidiobolaceae> Basidiobolus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.393 |
Instability index | 29.68 |
Isoelectric point | 4.69 |
Molecular weight | 15017.83 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP13779 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DQIRLL 2) EFPVTKA 3) PPDVFKKSTRELAADICKHA | 87 37 49 | 92 43 68 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab