<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13776
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MAQPPPQQPDDEPINSSFFPLPPPFYKQFTTENQKRLQDFKEAEGIYGEADTSPSLSADQILKLPPELRFLVPPEPPAEDNEFRVFGETSLINKAAPTLPDWGYEQLYPSPPTPAPGEDPSIQSEWSLNRAEYLQRLIRSILLKFLELLGVMSRDPTKWRDAMTDIGTMGANMHALINEYREHQMRETLILLMEDQLDKKRAEVDGVGKMKQKVEETLANFAKNVPRKLDNGESEDDTTSSPEVKRKEIQRYMWQAMDEILGQ |
| Length | 263 |
| Position | Middle |
| Organism | Clohesyomyces aquaticus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Lindgomycetaceae> Clohesyomyces.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.760 |
| Instability index | 60.41 |
| Isoelectric point | 4.70 |
| Molecular weight | 30106.66 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13776
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 149.76| 35| 44| 39| 82| 1
---------------------------------------------------------------------------
8- 39 (42.84/21.08) ...Q.......PDDEPINSS..FFPLPPPFykQFTTENQK.RLQD
46- 80 (63.83/24.69) IYGE.......ADTSPSLSADQILKLPPEL..RFLVPPEP.PAED
85- 119 (43.09/12.17) VFGEtslinkaAPTLPDWGYEQ...LYPS.......PPTPaPGED
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.04| 17| 44| 200| 218| 2
---------------------------------------------------------------------------
200- 218 (23.32/24.25) KRAEVDGVgkMKQKVEETL
245- 261 (31.73/24.06) KRKEIQRY..MWQAMDEIL
---------------------------------------------------------------------------
|