<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13765
| Description |
SURF5-domain-containing protein |
| Sequence | MSFLPVASSKEKKNKFVQNEEEYNKRLDSEIDQLIDSFHHIIKASMIGEHDKYKIFQEEYLINCMSSNIIRSAQSLLSLVSELKQSILLYDYKSLNSGILSRIETIEQEKLTISNILMSLCSDIRNTLKELEDVQYSSISFDMNEKNEEKNEEKIEEKSSRKTVETSDIKNEEKTK |
| Length | 176 |
| Position | Head |
| Organism | Anaeromyces robustus |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Neocallimastigomycetes> Neocallimastigales>
Neocallimastigaceae> Anaeromyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.690 |
| Instability index | 78.97 |
| Isoelectric point | 5.08 |
| Molecular weight | 20528.98 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13765
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.02| 22| 22| 74| 95| 1
---------------------------------------------------------------------------
74- 95 (33.47/17.18) QS.LLSLVSELKQSI.LLYD..YKSL
96- 113 (18.91/ 7.14) NSgILSRIETIEQEK.L.......TI
115- 139 (25.65/11.79) NI.LMSLCSDIRNTLkELEDvqYSSI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.99| 17| 35| 7| 23| 2
---------------------------------------------------------------------------
7- 23 (28.32/14.80) ASSKEKKNKFVQNEEEY
44- 60 (30.67/16.47) ASMIGEHDKYKIFQEEY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.72| 10| 18| 145| 154| 3
---------------------------------------------------------------------------
145- 154 (17.41/ 8.43) EKNEEKNEEK
165- 174 (17.30/ 8.35) ETSDIKNEEK
---------------------------------------------------------------------------
|