Description | SURF5-domain-containing protein |
Sequence | MSFLPVASSKEKKNKFVQNEEEYNKRLDSEIDQLIDSFHHIIKASMIGEHDKYKIFQEEYLINCMSSNIIRSAQSLLSLVSELKQSILLYDYKSLNSGILSRIETIEQEKLTISNILMSLCSDIRNTLKELEDVQYSSISFDMNEKNEEKNEEKIEEKSSRKTVETSDIKNEEKTK |
Length | 176 |
Position | Head |
Organism | Anaeromyces robustus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota> Chytridiomycota incertae sedis> Neocallimastigomycetes> Neocallimastigales> Neocallimastigaceae> Anaeromyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.690 |
Instability index | 78.97 |
Isoelectric point | 5.08 |
Molecular weight | 20528.98 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13765 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 78.02| 22| 22| 74| 95| 1 --------------------------------------------------------------------------- 74- 95 (33.47/17.18) QS.LLSLVSELKQSI.LLYD..YKSL 96- 113 (18.91/ 7.14) NSgILSRIETIEQEK.L.......TI 115- 139 (25.65/11.79) NI.LMSLCSDIRNTLkELEDvqYSSI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.99| 17| 35| 7| 23| 2 --------------------------------------------------------------------------- 7- 23 (28.32/14.80) ASSKEKKNKFVQNEEEY 44- 60 (30.67/16.47) ASMIGEHDKYKIFQEEY --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.72| 10| 18| 145| 154| 3 --------------------------------------------------------------------------- 145- 154 (17.41/ 8.43) EKNEEKNEEK 165- 174 (17.30/ 8.35) ETSDIKNEEK --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MSFLPVA 2) TVETSDIKNEEKT | 1 163 | 7 175 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab