<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13764

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMVNNNGAEQTNGLTSNNEVEPTKSELDVPNGTLPNNDEMEQVMHNMVPLRLIIERLVNQAYADLQNLTEVLPGMPIVERKRAILEYSLNTRQQFVKLLVLVKWAVNADKVQQCQNIIGFLQKQNEAFARTVDALYGIYTTMSQARVRNYDILTAIDVLTTGTYQRLPTIIRSHYIPLDPMEDNDVAGTLSKLNDLIRVRMICRETLPSPMNKYKIVNGRVVFRVEHEFEVSLTLFGAEEDVPWHIISLDILVCSEKSKVATDMDTSLTDYQIRNLIVNAQQKLIPQPPNPQKPSGPETEEGQEQPTEPSNPEESPESLKLPTYPMVRLHLLPFDAARSSLFTGNSLFTNSHNLSQMFNCGCSKALHLAKSRWAENLIVEINQFRTSIKLKYWCKRPPTTWSSVQYSSQQTTLTNCIEISVVNLEEYTPSQTEEDDVEGTSRSDTEDDTPSLKYPKGVLRVRCEGGADTDGKMIDTFEINPGELDVESLLMRIAELHARAVITRFRDILLNSSFVSNRIEFTKNDLEILDEQHVGTSKGQSSTCGLQVRYRQDRYLTLNVDIRTGRVVIGMSDKVMHDSDAKLRALEEKLNESFVKLPNLLLELKYATLIDDVENMARYLGLEPYPILPLRNEDIAKFGTTRSRMLYLQFTQHPSYYLVVSIVEDALNFRLISLGSPLSGSHLMTLASSVQLDLTSLLRQHQISTQATGQDSNTTHSPGSNARLPSKEVNELTIDLGLLSKIDSFCRARISFEKLEKQLTGLGIEFKYIQPIPLECDAADFCAQDSANPISQVPFMQIKPQDIPLRTKGASCSEIVSGSLNIRLADWYASGKSTCQVSMETRILSQSTPSIQDADQDAAKRLHFDHESRVLSFKYSDFDSCISQFLNDWETVIMVTLLAKQTYTTVNYFDLTLLKASYGKERFTIAIRWKSPNGTGSSRGHYKLALEENLGQIKQKNPHRKLRFCLEDYLNQTKDLKKLITLLNDTLPLLRALDELQRKRNAKDTFGKGLTIIPRHATHIRLQFPAKYVIDIRMSSATRLYISDAAYSFFEPPNTTPKKLGLPSPAHFPGDQAKVLLSRSHINPQPIPEFGQFIAHVGQALSQQSQYSQDEHAVVIPLQHGFVCGMSVSSFVLNELNSFIERTESTAAPTSAEISTKPPTQNLHSENPIEIV
Length1171
PositionTail
OrganismBasidiobolus meristosporus CBS 931.73
KingdomFungi
LineageEukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Entomophthoromycotina> Basidiobolomycetes> Basidiobolales> Basidiobolaceae> Basidiobolus.
Aromaticity0.07
Grand average of hydropathy-0.349
Instability index46.23
Isoelectric point5.88
Molecular weight132005.67
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU365082

GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13764
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     109.82|      27|      28|     755|     781|       1
---------------------------------------------------------------------------
  726-  751 (23.45/10.30)	.KEVNELTIDLGLLSK..IDSFCRArISF.
  755-  781 (48.02/28.42)	EKQLTGLGIEFKYIQP..IPLECDA.ADFC
  784-  811 (38.34/21.28)	DSANPISQVPFMQIKPqdIPLRTKG.AS.C
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.71|      13|      18|     289|     306|       2
---------------------------------------------------------------------------
  289-  306 (18.83/21.92)	NPQkpsgpETEEGQEQPT
  310-  322 (23.89/12.17)	NPE.....ESPESLKLPT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.73|      14|      18|     940|     953|       3
---------------------------------------------------------------------------
  940-  953 (25.35/15.97)	HYKL..ALEENLGQIK
  958-  973 (22.38/13.22)	HRKLrfCLEDYLNQTK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.15|      17|      18|      12|      29|       4
---------------------------------------------------------------------------
   12-   29 (25.19/21.97)	G.LTSNNEVEPTKSELdVP
   31-   48 (28.96/19.45)	GtLPNNDEMEQVMHNM.VP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.56|      23|      23|     151|     173|       5
---------------------------------------------------------------------------
  131-  149 (19.07/ 8.71)	.....V.DAL.YGIYTTMSQArVRNY
  151-  173 (38.25/25.11)	I.LTAI.DVLTTGTYQRLPTI.IRSH
  175-  197 (20.24/ 9.70)	IpLDPMeDNDVAGTLSKLNDL.IR..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      75.92|      23|      30|     816|     844|       6
---------------------------------------------------------------------------
  820-  844 (36.66/34.84)	NIRLADWYASGKstCQVSMETRILS
  849-  871 (39.26/20.14)	SIQDADQDAAKR..LHFDHESRVLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.09|      15|      30|      50|      64|       7
---------------------------------------------------------------------------
   50-   64 (24.69/15.68)	RLIIERLVN..QAYADL
   81-   97 (20.40/11.71)	RAILEYSLNtrQQFVKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.21|      16|      18|     414|     429|       8
---------------------------------------------------------------------------
  414-  429 (27.83/17.78)	NCIEISVVNLEEYTPS
  435-  450 (27.38/17.37)	DVEGTSRSDTEDDTPS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.45|      11|      29|     632|     647|       9
---------------------------------------------------------------------------
  632-  647 (13.87/21.04)	EDIAKFgttrsRMLYL
  663-  673 (18.58/10.61)	EDALNF.....RLISL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13764 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MVNNNGAEQTNGLTSNNEVEPTKSELDVPNGTLPNNDEME
2) QKLIPQPPNPQKPSGPETEEGQEQPTEPSNPEESPESL
1
281
40
318










Molecular Recognition Features






MoRF SequenceStartStop




NANANA