Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MEDEINIEDIDDLNFDDNFDDNINNDYEDKLVGDPLELLENKTMELINTLYNLNVIVYDFQPSSTQVLHNKINEVVEELKDLDDIKENIDIKIPQELLDDIEQGKNPDIFTNNLIKATVSQNQNTNGKIEAMKLLSNTLQKNIQNILPEDYELYQKLTNEK |
Length | 161 |
Position | Middle |
Organism | Anaeromyces robustus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota> Chytridiomycota incertae sedis> Neocallimastigomycetes> Neocallimastigales> Neocallimastigaceae> Anaeromyces. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.730 |
Instability index | 41.87 |
Isoelectric point | 4.05 |
Molecular weight | 18730.53 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13761 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 39.13| 13| 15| 77| 91| 1 --------------------------------------------------------------------------- 77- 91 (18.85/12.29) EELkdLDDIKE..NIDI 95- 109 (20.28/ 7.70) QEL..LDDIEQgkNPDI --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 32.72| 11| 18| 114| 124| 3 --------------------------------------------------------------------------- 114- 124 (18.39/ 9.81) LIKATVSQN.QN 134- 145 (14.33/ 6.39) LLSNTLQKNiQN --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DIKIPQELLDDI 2) PEDYELYQ | 90 148 | 101 155 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab