Description | Mediator of RNA polymerase II transcription subunit 4 (Fragment) |
Sequence | TTKCLAPTLQLSLSFISRSFKLSIQWTPSTCKTLHWSPCWTVCSPNTTPLCARYSASSTPKQTKTLTRTPRSVARKPPSAWPPWTATCRKSTPRSPPIQARQEEIRQTQLKSIASRSAKLHFIESILDSKRQLETTAFEARKTLDRAKLAADTMPEVTELIAYAKRISPYTKAPPNYDPKNSVVPAEPPYPVEVSMRMGVLNQYRARRAMKAERENLVEEDMHEFADAPDEFQFGDLEASDLLLGLDLNPDLE |
Length | 253 |
Position | Middle |
Organism | Linderina pennispora |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Kickxellomycotina> Kickxellomycetes> Kickxellales> Kickxellaceae> Linderina. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.570 |
Instability index | 53.25 |
Isoelectric point | 9.12 |
Molecular weight | 28537.30 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13750 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 110.97| 20| 20| 53| 72| 1 --------------------------------------------------------------------------- 21- 40 (39.33/18.45) KLSIQWTPSTCKTLHW.SPCW 53- 72 (35.71/16.16) RYSASSTPKQTKTLTR.TPRS 75- 95 (35.93/16.30) RKPPSAWPPWTATCRKsTPRS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) LIAYAKRI 2) QYRARRA | 160 203 | 167 209 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab