<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13748
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MAAGFSDTNIAELETLRGQLQQLQEQVNRNHAQLLQQMVVAPQKQLQSDHELQILSVLLRTKLAPEIERAEEQIKEQMEEEARTDQQQMAFGGQPDGAGNAKYWQAKTEVHDALALTAEVAFKELRKRHSNTAGSTGHGMDVDEAVKEEKAAVALEDVLAFVSSGTRA |
| Length | 168 |
| Position | Head |
| Organism | Linderina pennispora |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Kickxellomycotina>
Kickxellomycetes> Kickxellales> Kickxellaceae> Linderina.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.581 |
| Instability index | 56.72 |
| Isoelectric point | 4.96 |
| Molecular weight | 18562.52 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13748
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.27| 13| 50| 21| 43| 1
---------------------------------------------------------------------------
26- 40 (17.52/13.57) QVNRNHAqlLQQMVV
45- 57 (19.75/ 8.68) QLQSDHE..LQILSV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.25| 23| 44| 92| 116| 3
---------------------------------------------------------------------------
92- 116 (36.56/34.47) GGQPDGAgnAKYWQAKTEVHDALAL
139- 161 (36.69/26.45) GMDVDEA..VKEEKAAVALEDVLAF
---------------------------------------------------------------------------
|