<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13747
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSKDRNKERFQLELEFVQMLSNPQYLHWLAQEGYFNKPEFVNYLNYLQYWKKEEYSKFIMFPYCLAILDLLQHKEFRDSLANNDFALYVHKKQFNHWKYYRYSKNRNLKTNF |
Length | 112 |
Position | Middle |
Organism | Anaeromyces robustus |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Neocallimastigomycetes> Neocallimastigales>
Neocallimastigaceae> Anaeromyces.
|
Aromaticity | 0.21 |
Grand average of hydropathy | -0.855 |
Instability index | 37.29 |
Isoelectric point | 9.23 |
Molecular weight | 14129.98 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13747
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 71.51| 20| 21| 15| 34| 1
---------------------------------------------------------------------------
15- 31 (25.73/11.25) .............EFVQMLSNPQYLHWLAQ
32- 52 (25.19/10.89) EGY......fnkpEFVNYL...NYLQYWKK
53- 82 (20.58/ 7.89) EEYskfimfpyclAILDLLQHKEFRDSLAN
---------------------------------------------------------------------------
|