Description | Uncharacterized protein |
Sequence | MFRRARADDISAKEGEKHLVSNSAKLAEEQLNKRLDSEIEQLMNSFGEILAISKIQNSEGTAIARQRLGASAGMDDDDHPGWRGQSDSQSKDKYSVAQEAYSAQTRVATMVRTIEGLLGMVTDIKRAYLVNDATALTEMATRRRGKLDERRHITEQRVEELNSALDLAVRDLEKVYYSSKYIG |
Length | 183 |
Position | Head |
Organism | Linderina pennispora |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Fungi incertae sedis> Zoopagomycota> Kickxellomycotina> Kickxellomycetes> Kickxellales> Kickxellaceae> Linderina. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.676 |
Instability index | 55.38 |
Isoelectric point | 5.99 |
Molecular weight | 20539.77 |
Publications |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13738 No repeats found |
MoRF Sequence | Start | Stop |
1) DDHPGWRGQ 2) MFRRARA 3) TAIARQRLGASA | 77 1 61 | 85 7 72 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab