<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13723
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MEDEINIEDIDDFDNFDDNLNNDYEDKLVGDPLDLLENKTLELINTLYNLNVIVYDFQKESTPVLHNKINEVVNELKDLDEIKDNVDIKIPQELLDDVEQGKNPDIFSDNLIRETISQNQSTNGKIEAIKKLSRSLQKSIQNAYPKDFEIYQKLSNPKK |
| Length | 159 |
| Position | Middle |
| Organism | Piromyces finnis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Neocallimastigomycetes> Neocallimastigales>
Neocallimastigaceae> Piromyces.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.810 |
| Instability index | 33.65 |
| Isoelectric point | 4.27 |
| Molecular weight | 18486.29 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13723
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.24| 14| 21| 120| 133| 2
---------------------------------------------------------------------------
120- 133 (22.96/13.59) QSTNGK.IEAIKKLS
141- 155 (21.28/12.21) QNAYPKdFEIYQKLS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.18| 14| 21| 2| 15| 3
---------------------------------------------------------------------------
2- 15 (24.06/12.40) EDEINIEDIDDFDN
25- 38 (23.11/11.67) EDKLVGDPLDLLEN
---------------------------------------------------------------------------
|