<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13722
| Description |
SURF5-domain-containing protein |
| Sequence | MSFTNLDKKNKFVQNEEEYNKRLDTEIDQLIDSFHHIVKASKIGDSDKYKIFQEEYLINCMSSNIIRSAQSLLTLISELKQSILIFDYKSLNSGILSRIETIEQEKINVSDMLMSLQSDIRNNIKELEDVHYSSISFEIEDDDKSENIINDAEDNKNEEDKEIRNKS |
| Length | 167 |
| Position | Head |
| Organism | Piromyces finnis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Fungi incertae sedis> Chytridiomycota>
Chytridiomycota incertae sedis> Neocallimastigomycetes> Neocallimastigales>
Neocallimastigaceae> Piromyces.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.716 |
| Instability index | 87.70 |
| Isoelectric point | 4.62 |
| Molecular weight | 19521.53 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13722
No repeats found
|