Description | Uncharacterized protein |
Sequence | MDIVSQLQDQVDHIASLLFNHVGTLQRDAPPASLDKRAAKKEGAPHPEPLAAAVVQAARVLDELIAACPATAQGEEAQLARIEELQNESDRLGEEIREELEGAEADQEIVDAMFLSLADSCLPMAKKPNGATETRVVDASKQIDTHMSMDEDFPP |
Length | 155 |
Position | Middle |
Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae> Klebsormidiales> Klebsormidiaceae> Klebsormidium. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.372 |
Instability index | 54.58 |
Isoelectric point | 4.36 |
Molecular weight | 16765.57 |
Publications | PubMed=24865297 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP13697 No repeats found |
MoRF Sequence | Start | Stop |
1) AQLARIEELQ 2) LDKRAAKKE 3) RLGEEIREEL 4) VQAARVL | 77 34 91 55 | 86 42 100 61 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab