<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13695
| Description |
Surfeit locus protein 5 subunit 22 of Mediator complex][table7 |
| Sequence | MAQPTGKAQIGAGALGTSTLQAALQKQRNLQQRVDSDLNSLVENFSNMVAACKVQDQTRNTQEAFQIDVHVAKITQAAESLLDVVSELKQSAIFSNFEARNDQVAANNLKYEEKAASDAKTVERLRIVIEEAHTLSQSRRRENHVLNRELQIVRDAG |
| Length | 157 |
| Position | Head |
| Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae>
Klebsormidiales> Klebsormidiaceae> Klebsormidium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.506 |
| Instability index | 47.01 |
| Isoelectric point | 6.31 |
| Molecular weight | 17372.22 |
| Publications | PubMed=24865297
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13695
No repeats found
No repeats found
|