Description | Surfeit locus protein 5 subunit 22 of Mediator complex][table7 |
Sequence | MAQPTGKAQIGAGALGTSTLQAALQKQRNLQQRVDSDLNSLVENFSNMVAACKVQDQTRNTQEAFQIDVHVAKITQAAESLLDVVSELKQSAIFSNFEARNDQVAANNLKYEEKAASDAKTVERLRIVIEEAHTLSQSRRRENHVLNRELQIVRDAG |
Length | 157 |
Position | Head |
Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae> Klebsormidiales> Klebsormidiaceae> Klebsormidium. |
Aromaticity | 0.03 |
Grand average of hydropathy | -0.506 |
Instability index | 47.01 |
Isoelectric point | 6.31 |
Molecular weight | 17372.22 |
Publications | PubMed=24865297 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP13695 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) HVLNRELQIVRDAG 2) TVERLRIVIEEAHTL | 144 121 | 157 135 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab