<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13692

Description Molecular chaperones HSP70/HSC70
SequenceMGRLQGWTSLILLAALFAVTYAADEANPLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGSRITPSWVAFTDTERLIGEAAKNQAAQNHERTVFDVKRLIGRKFSDKDVQRDLKLLPYKIINKESKPNIEVKLKDGEVKVFSPEEISAMILIKMKETAEAYLGKKIKDAVVTVPAYFNDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKQGEKNILVFDLGGGTFDVSILTIDGGVFEVVSTNGDTHLGGEDFDQRIMEYFIKLIKKKYNKDISKDNRALGKLRREAERAKRALSNQHQVRVEIESLFDGTDLSEPLTRARFEELNNDLFKKTMGPVKKAMDDAGFKKTDIDEIVLVGGSTRIPKVQQLIKEFFDGKEPNKGINPDEAVAYGAAVQGGILSGEGGEETKDLLLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSLTKDCHELGKFDLSGIPPAPRGVPQIEVTFEVDANGILSVSAEDKGTGKAEKITITNDKGRLSQEDIERMVAEAEEFAEEDKKIKERIDARNHLETYVYNMKNTINDSDKLGDKISEDDKESIEAAIKDTLEWMDDNQSADKEEYEEKLKEVEGVCNPIISKLYQAAGPGAGGADEDEDVEHDEL
Length659
PositionUnknown
OrganismKlebsormidium nitens (Green alga) (Ulothrix nitens)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae> Klebsormidiales> Klebsormidiaceae> Klebsormidium.
Aromaticity0.06
Grand average of hydropathy-0.440
Instability index29.18
Isoelectric point4.91
Molecular weight72613.19
Publications
PubMed=24865297

Function

Annotated function 
GO - Cellular Component
endoplasmic reticulum	GO:0005783	IEA:UniProtKB-KW

GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-KW
ATPase activity	GO:0016887	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP13692
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.24|      16|      20|      72|      90|       1
---------------------------------------------------------------------------
   72-   87 (26.16/22.35)	DTERLIGEAAKNQAAQ
   95-  110 (27.08/12.84)	DVKRLIGRKFSDKDVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.30|      11|      26|     226|     236|       2
---------------------------------------------------------------------------
  226-  236 (20.46/10.88)	LGGGTFDVSIL
  254-  264 (21.85/12.06)	LGGEDFDQRIM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.75|      26|     193|     200|     225|       3
---------------------------------------------------------------------------
  200-  225 (46.01/27.76)	INEPTA....AAIAYG.LDKKQGE..KNILVFD
  389-  421 (30.74/16.19)	INPDEAvaygAAVQGGiLSGEGGEetKDLLLLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.15|      17|      19|     587|     603|       5
---------------------------------------------------------------------------
  587-  603 (26.96/14.79)	DKISEDDKESIEAAIKD
  609-  625 (28.19/15.77)	DDNQSADKEEYEEKLKE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.15|      21|      21|     314|     334|       9
---------------------------------------------------------------------------
  314-  334 (35.50/21.43)	FDGT..DLSEPLTRARFEELNND
  336-  358 (30.65/17.56)	FKKTmgPVKKAMDDAGFKKTDID
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.29|      18|      22|     495|     513|      10
---------------------------------------------------------------------------
  495-  513 (27.10/21.32)	RGVPQIE.VTFEVDaNGILS
  519-  537 (26.19/15.46)	KGTGKAEkITITND.KGRLS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP13692 with Med37 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) SDKLGDKISEDDKESIEAAIKDTLEWMDDNQSADKEEYEEKLKE
582
625










Molecular Recognition Features






MoRF SequenceStartStop




1) YEEKLKEVEGVCNPIISKLYQ
619
639