<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13689
| Description |
Cyclin family protein |
| Sequence | MAADFWASYQSKQLLSVEEVSRVAEEDLELGLTLQDTRLIKIAMTTYMRDLAQQAKLRQRVVATAVCYMRRMYVSKSLCEYDPRLVAPACLYLASKAEESVAQAKLLVFYAKKLKPGPENGAYQLEVKDLLDMELRVLEALDFRLVVYHPYRAAVQYLNDAKLTDVMQTTWSLLNDVYRTDLPLLHPPHVVALGCIHLAAFLKDRDAKPWLEDLKADMHAVRAVQMELLDHYEQYANIDPALTAAAMAKLPIRTRAART |
| Length | 259 |
| Position | Kinase |
| Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae>
Klebsormidiales> Klebsormidiaceae> Klebsormidium.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.068 |
| Instability index | 38.60 |
| Isoelectric point | 6.60 |
| Molecular weight | 29490.02 |
| Publications | PubMed=24865297
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13689
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.49| 15| 19| 35| 49| 1
---------------------------------------------------------------------------
35- 49 (26.71/13.99) QDTRLIKIAMTT...YMR
53- 70 (20.78/ 9.78) QQAKLRQRVVATavcYMR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.04| 13| 26| 123| 135| 2
---------------------------------------------------------------------------
123- 135 (21.98/13.00) YQLEVKDLLDMEL
151- 163 (22.06/13.07) YRAAVQYLNDAKL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.82| 12| 103| 83| 94| 3
---------------------------------------------------------------------------
83- 94 (23.18/13.39) PRLVAPACLYLA
188- 199 (23.64/13.77) PHVVALGCIHLA
---------------------------------------------------------------------------
|