<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13684
Description |
Hydroxyproline-rich glycoprotein family protein |
Sequence | MKMHRAEQAMEDVLDKCSMYKRPKLSNNLVEESWKEGQRRIAIGDIVSYAHKISYSTFAPPSFITNQELPPGFQPPAPQAEHMRASALYQFSDEELGFRPVPSATPLELKAPEPSASAPEALPKPPPGWKPGMPVELPPMPPGWKPGMELPPPPLALANLPPMPPGWKPGDPVPLPVVQPQIPPPERLRPQAQPIQVAHVDLDLNPDLEGGFYSSESEDEDDDSESEEE |
Length | 229 |
Position | Middle |
Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae>
Klebsormidiales> Klebsormidiaceae> Klebsormidium.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.684 |
Instability index | 80.27 |
Isoelectric point | 4.63 |
Molecular weight | 25238.33 |
Publications | PubMed=24865297
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13684
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 136.95| 39| 103| 60| 100| 3
---------------------------------------------------------------------------
60- 98 (75.13/28.59) PPSFITNQELPPGF...........QPPAPQAEHMRASA.........LYQFSDEELGF
154- 212 (61.81/18.58) PLALANLPPMPPGWkpgdpvplpvvQPQIPPPERLRPQAqpiqvahvdLDLNPDLEGGF
---------------------------------------------------------------------------
|