<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13679
| Description |
Cyclin-dependent kinase |
| Sequence | MDRSGGGTASSAARAKAVARPSWWDLYEVVGKIGEGTYGLVYLVRVKDKAQGYKLAIKKFKPSKDGDGVSPTAIREIMLLRECCHENIVKLVNVHINHADASLYLAFDYAEYDLYEIIRFHREKLQYAISPYTVKSLMWQILNGLHYLHSNWIIHRDLKPSNILVMREGDEAGVVKLGDFGLARIYQAPLKPLSDNGVVVTVWYRSPDLLLGAKHYTPAVDVWAVGCIFAELLTLKPLFQGVEDKGMHNPFQIDQIDKIFKVLGPPSVDTWPGLAHLPYWQHNRQSIQNKKYDHPLLPSMTAHFAKTAAYDLLTKMFEYDPAKRLTAEQALKHEYFRQEPLPGKNSFVSGYPGEKVVVYPSRPVDTSLDMGSNEPTPVGNTANPASGQQRRFQQQGGDQSGSGQGGTTTGSRLGPGGSGRRSDGRSQGQGPSKMQRR |
| Length | 437 |
| Position | Kinase |
| Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae>
Klebsormidiales> Klebsormidiaceae> Klebsormidium.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.444 |
| Instability index | 42.89 |
| Isoelectric point | 9.22 |
| Molecular weight | 48654.84 |
| Publications | PubMed=24865297
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP13679
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.35| 15| 17| 292| 308| 1
---------------------------------------------------------------------------
292- 308 (24.33/22.94) YDhpLLPSMTAH.FAK..TA
310- 327 (20.02/10.72) YD..LLTKMFEYdPAKrlTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.08| 25| 46| 218| 245| 8
---------------------------------------------------------------------------
218- 245 (35.53/35.05) PAVDVWAvGciFAELLTLKPLFQGVEDK
266- 290 (50.55/34.62) PSVDTWP.G..LAHLPYWQHNRQSIQNK
---------------------------------------------------------------------------
|