<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13672
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MASTYPPPPPYFKLFSDGYKGEQILPPPPLDGTFTMFGQTYSTEDQLPNLEQQGIRQLYPKHSDIDIPAELRKLNRELVFTYLELVDVLAERPSQYARRVEDIGLILKNMHHLLNLLRPHQAQATVLHALEEQVRRRKEALATIRKQRQEMAAALAEGASLLAEANQELLQKIGASNQPEGLR |
Length | 183 |
Position | Middle |
Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae>
Klebsormidiales> Klebsormidiaceae> Klebsormidium.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.501 |
Instability index | 57.06 |
Isoelectric point | 6.22 |
Molecular weight | 20792.55 |
Publications | PubMed=24865297
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13672
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.17| 19| 19| 7| 25| 1
---------------------------------------------------------------------------
7- 25 (39.14/21.23) PPPPY...FKLFSDGYKGEQIL
26- 47 (34.03/17.74) PPPPLdgtFTMFGQTYSTEDQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.31| 15| 15| 118| 132| 2
---------------------------------------------------------------------------
110- 126 (23.83/14.27) MHHLLN.llRPHQAQATV
127- 144 (17.49/ 8.75) LHALEEqvrRRKEALATI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 29.18| 10| 19| 149| 160| 3
---------------------------------------------------------------------------
149- 160 (12.23/13.51) QEMAAALaeGAS
167- 176 (16.95/10.39) QELLQKI..GAS
---------------------------------------------------------------------------
|