<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13670
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MGVKWLLRWQPPTSLPLTTPMFEEILANAEAIGAQQGGRWQLTSTLYRPIVREAKGGEPAAVRDLFMITGTEHPEKLWLVVRQEKQVLVADASLLAILDKVQLYKQRTAVTFEGRVYEMGDFRLRLGRAVFSINEQLRGITLEVEYLPTQSSAQAVPMLTEFFAVWDESLKSKSLLGKFVVVDPLFEEFGLSDNYSLQHMALHYVYLSTLFLIGTRVS |
Length | 218 |
Position | Head |
Organism | Klebsormidium nitens (Green alga) (Ulothrix nitens) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Klebsormidiophyceae>
Klebsormidiales> Klebsormidiaceae> Klebsormidium.
|
Aromaticity | 0.11 |
Grand average of hydropathy | 0.044 |
Instability index | 39.58 |
Isoelectric point | 5.97 |
Molecular weight | 24724.37 |
Publications | PubMed=24865297
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13670
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.69| 17| 28| 8| 30| 1
---------------------------------------------------------------------------
8- 30 (25.37/26.88) RWQpptslpLTTPMFEEILANAE
39- 55 (31.32/17.20) RWQ......LTSTLYRPIVREAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 80.21| 24| 28| 159| 186| 2
---------------------------------------------------------------------------
161- 186 (37.00/32.22) EFFAVWDESLKSKSLlgKFVVVDPLF
188- 211 (43.21/24.08) EFGLSDNYSLQHMAL..HYVYLSTLF
---------------------------------------------------------------------------
|