<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13669
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | METNEPLKTQLHSKLNDFSSLTRTLLELINSDKPNVSIGGGPAKTGETGEMTLSGVLDKLIDRDKEIQALVETAIQMRGRQRDIDWFENQIDMRKNDLEDLQNRLYDAEKLLELTVHQGKQKLDSIEKAQQGAVSPEKLIHYAHKISQASTAVSPVGWQPSDPRRPYPQDTEMRAGILCRLSTSGKLTPDDPPGDSKPAIGGSSIGMNQNNNQSNAVIKDQQQQPNSVLDQEPMSEDTSLSSSDEGM |
Length | 247 |
Position | Middle |
Organism | Amphimedon queenslandica (Sponge) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.817 |
Instability index | 41.93 |
Isoelectric point | 4.88 |
Molecular weight | 27279.07 |
Publications | PubMed=20686567
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP13669
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.85| 13| 29| 21| 33| 1
---------------------------------------------------------------------------
21- 33 (21.19/14.51) LTRTLLELINSDK
53- 65 (21.66/14.98) LSGVLDKLIDRDK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.92| 19| 26| 154| 176| 2
---------------------------------------------------------------------------
154- 176 (33.76/25.16) SPVG.WQPSDPrrpyPQDTEMRAG
182- 201 (32.15/14.72) STSGkLTPDDP....PGDSKPAIG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.92| 23| 25| 98| 121| 4
---------------------------------------------------------------------------
98- 121 (33.36/30.06) LEDLQNRLYDAEKLLELTvHQGKQ
126- 148 (38.56/29.40) IEKAQQGAVSPEKLIHYA.HKISQ
---------------------------------------------------------------------------
|