| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MASNNKLMMSWHDRSWIPNLNQDNIMDYFSQRSNPFYDRTCNNEVIRMQRGDPSHLVNMTGIEYSLFLVQEPVLYVIKKVHRQSPEKVIPLANYYVLGGVVYQCPDLHSVINSRLLSSLHLIHQAFEEAQSYARYGPSQGYYWKFPGDSEETTSQTTSKTKNEPSEMQRKRVDGLLLELIKQFPPKVVQPKEDGKPLPSAPGVTVRGESVDSKTVPQAPNAKQPAAPPISINSEIKLPDTKRKKLN |
| Length | 246 |
| Position | Head |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha> Haplosclerida> Niphatidae> Amphimedon. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.647 |
| Instability index | 57.70 |
| Isoelectric point | 9.05 |
| Molecular weight | 27984.55 |
| Publications | PubMed=20686567 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP13659
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.83| 22| 44| 74| 95| 1
---------------------------------------------------------------------------
74- 95 (39.02/25.97) LYVIKKVHR..QSPEKVIPLANYY
119- 142 (36.81/24.13) LHLIHQAFEeaQSYARYGPSQGYY
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) GYYWKFPG 2) PAAPPISINSEIKLPDTKRKKLN | 140 224 | 147 246 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab