<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13652
| Description |
Uncharacterized protein |
| Sequence | MASNSDAGFKVSVESLHTTRVKEINYDGEEIYEGRPSLSQKLSELAQHVDFREERADDDNDREEGKKQEEEEVEGVSGPTTKKPSHRWPWEFTHSKLKQALTEVSVLSDVLQIVHNHHQYLSLDPVYVNKKYTLPPSYQYQTKKKALDIASKILRKGAEPLKRLSSQTDHKFYRALYDLRRRWILHRTANGVKGDLSYRQLQKQLADKIQRYI |
| Length | 213 |
| Position | Head |
| Organism | Amphimedon queenslandica (Sponge) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.977 |
| Instability index | 51.35 |
| Isoelectric point | 9.02 |
| Molecular weight | 24866.61 |
| Publications | PubMed=20686567
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP13652
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.23| 13| 14| 178| 190| 1
---------------------------------------------------------------------------
178- 190 (23.70/14.50) DLRRRWILHRTAN
195- 207 (21.53/12.65) DLSYRQLQKQLAD
---------------------------------------------------------------------------
|