<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP13647
Description |
Uncharacterized protein |
Sequence | MYLYKQEQALTEVSVLSDVLQIVHNHHQYLSLDPVYVNKKYTLPPSYQCQIKKKILRKGAEPLQRLSSQTDHKFYRALYDLRRKWIPRRTANGVSGDLSYRSVTR |
Length | 105 |
Position | Head |
Organism | Amphimedon queenslandica (Sponge) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Porifera> Demospongiae> Heteroscleromorpha>
Haplosclerida> Niphatidae> Amphimedon.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.686 |
Instability index | 57.51 |
Isoelectric point | 9.91 |
Molecular weight | 12439.18 |
Publications | PubMed=20686567
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP13647
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.69| 10| 29| 52| 61| 1
---------------------------------------------------------------------------
52- 61 (16.17/10.59) KKKILRKGAE
83- 92 (19.52/13.90) RKWIPRRTAN
---------------------------------------------------------------------------
|